USH1C Antibody [mFluor Violet 450 SE]

Product Discontinued

USH1C Antibody [mFluor Violet 450 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of zebrafish USH1C (NP_001035018.1).
  
  Sequence:
  MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for USH1C Antibody [mFluor Violet 450 SE]

• AIE75
• AIE-75
• Antigen NY-CO-38/NY-CO-37
• Autoimmune enteropathy-related antigen AIE-75
• deafness, autosomal recessive 18
• DFNB18
• harmonin
• NY-CO-37
• NY-CO-38
• PDZ-45
• PDZ73
• PDZ-73
• PDZ-73/NY-CO-38
• Protein PDZ-73
• Renal carcinoma antigen NY-REN-3
• ush1cpst
• Usher syndrome 1C (autosomal recessive, severe)
• Usher syndrome type-1C protein

Background

USH1C may be involved in protein-protein interaction. Defects in USH1C are the cause of Usher syndrome type 1c. It is an autosomal recessive sensory defect involving congenital profound sensorineural deafness, vestibular dysfunction, and blindness due to progressive retinitis pigmentosa. Defects in USH1C are also the cause of nonsyndromic recessive deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.