USH1C Antibody [Alexa Fluor® 647]

Images

 

Product Details

Summary
Product Discontinued
View other related USH1C Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38088AF647
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USH1C Antibody [Alexa Fluor® 647] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of zebrafish USH1C (NP_001035018.1).

Sequence:
MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for USH1C Antibody [Alexa Fluor® 647]

  • AIE75
  • AIE-75
  • Antigen NY-CO-38/NY-CO-37
  • Autoimmune enteropathy-related antigen AIE-75
  • deafness, autosomal recessive 18
  • DFNB18
  • harmonin
  • NY-CO-37
  • NY-CO-38
  • PDZ-45
  • PDZ73
  • PDZ-73
  • PDZ-73/NY-CO-38
  • Protein PDZ-73
  • Renal carcinoma antigen NY-REN-3
  • ush1cpst
  • Usher syndrome 1C (autosomal recessive, severe)
  • Usher syndrome type-1C protein

Background

USH1C may be involved in protein-protein interaction. Defects in USH1C are the cause of Usher syndrome type 1c. It is an autosomal recessive sensory defect involving congenital profound sensorineural deafness, vestibular dysfunction, and blindness due to progressive retinitis pigmentosa. Defects in USH1C are also the cause of nonsyndromic recessive deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-21878
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP3-03833
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-89076
Species: Ca, Hu
Applications: IHC,  IHC-P, WB
NBP1-69142
Species: Hu
Applications: WB
NBP2-57048
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00025861-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85885
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-17529
Species: Hu
Applications: ICC/IF
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-87850
Species: Hu
Applications: IHC,  IHC-P

Publications for USH1C Antibody (NBP3-38088AF647) (0)

There are no publications for USH1C Antibody (NBP3-38088AF647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USH1C Antibody (NBP3-38088AF647) (0)

There are no reviews for USH1C Antibody (NBP3-38088AF647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USH1C Antibody (NBP3-38088AF647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USH1C Products

Blogs on USH1C.

Auditory Infographic: Can you hear me now?
The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below. Novus Biologicals offers reagents mentioned in the inf...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USH1C Antibody [Alexa Fluor® 647] and receive a gift card or discount.