UNC93A Antibody


Western Blot: UNC93A Antibody [NBP1-90576] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: UNC93A Antibody [NBP1-90576] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

UNC93A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR
Specificity of human UNC93A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UNC93A Protein (NBP1-90576PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for UNC93A Antibody

  • dJ366N23.1 (putative C. elegans UNC-93 (protein 1, C46F11.1) LIKE)
  • dJ366N23.1
  • dJ366N23.2 (putative C. elegans UNC-93 (protein 1, C46F11.1) C-terminal LIKE)
  • dJ366N23.2
  • unc-93 homolog A (C. elegans)
  • unc93 homolog A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UNC93A Antibody (NBP1-90576) (0)

There are no publications for UNC93A Antibody (NBP1-90576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC93A Antibody (NBP1-90576) (0)

There are no reviews for UNC93A Antibody (NBP1-90576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNC93A Antibody (NBP1-90576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UNC93A Products

UNC93A NBP1-90576

Bioinformatics Tool for UNC93A Antibody (NBP1-90576)

Discover related pathways, diseases and genes to UNC93A Antibody (NBP1-90576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC93A Antibody (NBP1-90576)

Discover more about diseases related to UNC93A Antibody (NBP1-90576).

Pathways for UNC93A Antibody (NBP1-90576)

View related products by pathway.

Blogs on UNC93A

There are no specific blogs for UNC93A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UNC93A Antibody and receive a gift card or discount.


Gene Symbol UNC93A