TWISTNB Antibody

Images

 
Western Blot: TWISTNB Antibody [NBP1-89449] - Analysis in human cell line U-937 MG.
Immunocytochemistry/ Immunofluorescence: TWISTNB Antibody [NBP1-89449] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: TWISTNB Antibody [NBP1-89449] - Staining of human cerebellum shows cytoplasmic and nucleolar positivity in Purkinje cells.
Western Blot: TWISTNB Antibody [NBP1-89449] - Analysis of 293T cells lysate after siren treatment with siTWISTNB and siControl. Image from verified customer review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TWISTNB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TWISTNB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TWISTNB Protein (NBP1-89449PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89449 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TWISTNB Antibody

  • DNA-directed RNA polymerase I subunit RPA43
  • Twist neighbor protein
  • TWIST neighbor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
H00023161-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-91897
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TWISTNB Antibody (NBP1-89449) (0)

There are no publications for TWISTNB Antibody (NBP1-89449).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TWISTNB Antibody (NBP1-89449) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-89449:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TWISTNB NBP1-89449
Enlarge
reviewed by:
Anonymous
WB Human 09/03/2014
View

Summary

ApplicationWestern Blot
Sample Tested293T cells lysate after siren treatment with siTWISTNB and siControl
SpeciesHuman

Blocking

Blocking Details5% BSA in PBS

Primary Anitbody

Dilution Ratio1:2000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

Secondary Descriptionanti-rabbit IgG HRP conjugate (Jackson Labs)
Secondary Manufacturer Cat#111-005-045
Secondary Concentration1:20:000

Details

Detection NotesProbed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 20 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TWISTNB Antibody (NBP1-89449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TWISTNB Products

Bioinformatics Tool for TWISTNB Antibody (NBP1-89449)

Discover related pathways, diseases and genes to TWISTNB Antibody (NBP1-89449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TWISTNB Antibody (NBP1-89449)

Discover more about diseases related to TWISTNB Antibody (NBP1-89449).

Blogs on TWISTNB

There are no specific blogs for TWISTNB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/03/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol TWISTNB