TTC36 Antibody

Images

 
Western Blot: TTC36 Antibody [NBP1-93702] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TTC36 Antibody [NBP1-93702] - Staining in human liver and tonsil tissues using anti-TTC36 antibody. Corresponding TTC36 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: TTC36 Antibody [NBP1-93702] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: TTC36 Antibody [NBP1-93702] - Staining of human tonsil shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TTC36 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVMAAEA
Specificity
Specificity of human, mouse, rat TTC36 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC36 Antibody

  • HBP21
  • tetratricopeptide repeat domain 36
  • tetratricopeptide repeat protein 36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KD

Publications for TTC36 Antibody (NBP1-93702) (0)

There are no publications for TTC36 Antibody (NBP1-93702).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC36 Antibody (NBP1-93702) (0)

There are no reviews for TTC36 Antibody (NBP1-93702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC36 Antibody (NBP1-93702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TTC36 Products

Bioinformatics Tool for TTC36 Antibody (NBP1-93702)

Discover related pathways, diseases and genes to TTC36 Antibody (NBP1-93702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC36

There are no specific blogs for TTC36, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC36
Novus 100% Guarantee