Recombinant Human TSNAXIP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TSNAXIP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-366 of Human TSNAXIP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQLHMSTLKERDQFFSELQEIQRTSTPRPDWTKCKDVVAGGPERWQMLAEGKNSDQLVDVLLEEIGSGLLREKDFFPGLGYGEAIPAFLRFDGLVENKKPSKKDVVNLLKDAWKERLAEEQKETFPDFFFNFLEHRFGPSDAMAWAYTIFENIKIFHSNEVMSQFYAVLMGKRSENVYVTQKETVAQLLKEMTNADSQNEGLLTMEQFNTVLKSTFPLKTEEQIQELMEAGGWHPSSSNADLLNYRSLFMEDEEGQSEPFVQKLWEQYMDEKDEYLQQLKQELGIELHEEVTLPKLRGGLMTIDPSLDKQTVNTYMSQAFQLPESEMPEEGDEKEEAVVEILQTALERLQVIDIRRVGPREPEPAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TSNAXIP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSNAXIP1 Protein

  • MGC111443
  • translin-associated factor X interacting protein 1
  • translin-associated factor X-interacting protein 1
  • TXI1Trax-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76581
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74351
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for TSNAXIP1 Recombinant Protein (H00055815-P01) (0)

There are no publications for TSNAXIP1 Recombinant Protein (H00055815-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSNAXIP1 Recombinant Protein (H00055815-P01) (0)

There are no reviews for TSNAXIP1 Recombinant Protein (H00055815-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSNAXIP1 Recombinant Protein (H00055815-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSNAXIP1 Products

Bioinformatics Tool for TSNAXIP1 Recombinant Protein (H00055815-P01)

Discover related pathways, diseases and genes to TSNAXIP1 Recombinant Protein (H00055815-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSNAXIP1 Recombinant Protein (H00055815-P01)

Discover more about diseases related to TSNAXIP1 Recombinant Protein (H00055815-P01).
 

Pathways for TSNAXIP1 Recombinant Protein (H00055815-P01)

View related products by pathway.

Blogs on TSNAXIP1

There are no specific blogs for TSNAXIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SUN1 Antibody
NBP1-87396
TSNAXIP1 Antibody
H00055815-B01P
MEA-1 Antibody
NBP1-81245

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSNAXIP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSNAXIP1