TSGA13 Antibody

Images

 
Western Blot: TSGA13 Antibody [NBP1-70739] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSGA13 Antibody Summary

Immunogen
Synthetic peptides corresponding to TSGA13(testis specific, 13) The peptide sequence was selected from the middle region of TSGA13. Peptide sequence ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSGA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TSGA13 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSGA13 Antibody

  • testis specific, 13
  • testis-specific A13

Background

The specific function of TSGA13 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-92538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82564
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-09427
Species: Hu
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP1-81528
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57636
Species: Hu
Applications: WB
NBP2-01992
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
A-605
Species: Hu
Applications: WB
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85494
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TSGA13 Antibody (NBP1-70739) (0)

There are no publications for TSGA13 Antibody (NBP1-70739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSGA13 Antibody (NBP1-70739) (0)

There are no reviews for TSGA13 Antibody (NBP1-70739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSGA13 Antibody (NBP1-70739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSGA13 Products

TSGA13 NBP1-70739

Bioinformatics Tool for TSGA13 Antibody (NBP1-70739)

Discover related pathways, diseases and genes to TSGA13 Antibody (NBP1-70739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSGA13 Antibody (NBP1-70739)

Discover more about diseases related to TSGA13 Antibody (NBP1-70739).

Blogs on TSGA13

There are no specific blogs for TSGA13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSGA13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSGA13