TP53TG5 Antibody


Immunohistochemistry-Paraffin: TP53TG5 Antibody [NBP2-13467] - Staining of human testis shows high expression.
Immunohistochemistry: TP53TG5 Antibody [NBP2-13467] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: TP53TG5 Antibody [NBP2-13467] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TP53TG5 Antibody [NBP2-13467] - Staining in human testis and prostate tissues using anti-TP53TG5 antibody. Corresponding TP53TG5 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TP53TG5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SSLLKLLKSSNHRIQELHKLAKRCWHSLLSVPKILRISSGENSACNKTKQ NNEEFQEIGCSEKELKSKKL
Specificity of human TP53TG5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TP53TG5 Protein (NBP2-13467PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TP53TG5 Antibody

  • C20orf10
  • chromosome 20 open reading frame 10
  • CLG01
  • dJ453C12.5
  • TP53 target 5
  • TP53-inducible gene 5 protein
  • TP53-target gene 5 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: IHC, IHC-P

Publications for TP53TG5 Antibody (NBP2-13467) (0)

There are no publications for TP53TG5 Antibody (NBP2-13467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TP53TG5 Antibody (NBP2-13467) (0)

There are no reviews for TP53TG5 Antibody (NBP2-13467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TP53TG5 Antibody (NBP2-13467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TP53TG5 Products

Bioinformatics Tool for TP53TG5 Antibody (NBP2-13467)

Discover related pathways, diseases and genes to TP53TG5 Antibody (NBP2-13467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TP53TG5 Antibody (NBP2-13467)

Discover more about diseases related to TP53TG5 Antibody (NBP2-13467).

Pathways for TP53TG5 Antibody (NBP2-13467)

View related products by pathway.

Research Areas for TP53TG5 Antibody (NBP2-13467)

Find related products by research area.

Blogs on TP53TG5

There are no specific blogs for TP53TG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TP53TG5 Antibody and receive a gift card or discount.


Gene Symbol TP53TG5