TP53TG5 Antibody

Images

 
Immunohistochemistry: TP53TG5 Antibody [NBP2-13467] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TP53TG5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSLLKLLKSSNHRIQELHKLAKRCWHSLLSVPKILRISSGENSACNKTKQ NNEEFQEIGCSEKELKSKKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TP53TG5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TP53TG5 Protein (NBP2-13467PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TP53TG5 Antibody

  • C20orf10
  • chromosome 20 open reading frame 10
  • CLG01
  • dJ453C12.5
  • TP53 target 5
  • TP53-inducible gene 5 protein
  • TP53-target gene 5 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-13467
Species: Hu
Applications: IHC, IHC-P

Publications for TP53TG5 Antibody (NBP2-13467) (0)

There are no publications for TP53TG5 Antibody (NBP2-13467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TP53TG5 Antibody (NBP2-13467) (0)

There are no reviews for TP53TG5 Antibody (NBP2-13467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TP53TG5 Antibody (NBP2-13467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TP53TG5 Products

Bioinformatics Tool for TP53TG5 Antibody (NBP2-13467)

Discover related pathways, diseases and genes to TP53TG5 Antibody (NBP2-13467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TP53TG5 Antibody (NBP2-13467)

Discover more about diseases related to TP53TG5 Antibody (NBP2-13467).
 

Pathways for TP53TG5 Antibody (NBP2-13467)

View related products by pathway.

Research Areas for TP53TG5 Antibody (NBP2-13467)

Find related products by research area.

Blogs on TP53TG5

There are no specific blogs for TP53TG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TP53TG5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53TG5