TMEM250 Antibody


Immunocytochemistry/ Immunofluorescence: C9orf69 Antibody [NBP2-49472] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: C9orf69 Antibody [NBP2-49472] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TMEM250 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLY
Specificity of human C9orf69 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM250 Recombinant Protein Antigen (NBP2-49472PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM250 Antibody

  • BA83N9.1
  • Chromosome 9 Open Reading Frame 69
  • Herpes Virus UL25-Binding Protein
  • TMEM250


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TMEM250 Antibody (NBP2-49472) (0)

There are no publications for TMEM250 Antibody (NBP2-49472).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM250 Antibody (NBP2-49472) (0)

There are no reviews for TMEM250 Antibody (NBP2-49472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM250 Antibody (NBP2-49472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TMEM250 Products

Bioinformatics Tool for TMEM250 Antibody (NBP2-49472)

Discover related pathways, diseases and genes to TMEM250 Antibody (NBP2-49472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM250

There are no specific blogs for TMEM250, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM250 Antibody and receive a gift card or discount.


Gene Symbol TMEM250