Recombinant Human TMEM16K Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMEM16K Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-392 of Human FLJ10375 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIENHRLESAYQNHLILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFEMMSVISVVTNCALIGMSPQVNAAFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQMKLVTENLKEEPMESGKEKAT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ANO10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEM16K Protein

  • anoctamin 10
  • FLJ10375
  • MGC47890
  • Transmembrane protein 16KTMEM16Kanoctamin-10

Background

FLJ10375( AAH38855, 1 a.a. - 393 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74204
Species: Mu
Applications: WB
NBP1-31129
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86688
Species: Hu
Applications: IHC, IHC-P
NB100-98846
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-14298
Species: Hu
Applications: IHC, IHC-P
NBP2-14673
Species: Hu
Applications: IHC, IHC-P
NBP2-32401
Species: Hu
Applications: IHC, IHC-P
NBP1-83099
Species: Hu
Applications: IHC, IHC-P
NBP2-49081
Species: Hu
Applications: WB, IHC
H00255928-R01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00055129-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TMEM16K Recombinant Protein (H00055129-P01) (0)

There are no publications for TMEM16K Recombinant Protein (H00055129-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM16K Recombinant Protein (H00055129-P01) (0)

There are no reviews for TMEM16K Recombinant Protein (H00055129-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM16K Recombinant Protein (H00055129-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM16K Products

Bioinformatics Tool for TMEM16K Recombinant Protein (H00055129-P01)

Discover related pathways, diseases and genes to TMEM16K Recombinant Protein (H00055129-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM16K Recombinant Protein (H00055129-P01)

Discover more about diseases related to TMEM16K Recombinant Protein (H00055129-P01).
 

Pathways for TMEM16K Recombinant Protein (H00055129-P01)

View related products by pathway.

Blogs on TMEM16K

There are no specific blogs for TMEM16K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMEM16K Antibody
NBP1-59667

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMEM16K Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANO10