TMEM126B Antibody


Western Blot: TMEM126B Antibody [NBP1-83157] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: TMEM126B Antibody [NBP1-83157] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TMEM126B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENC
Specificity of human TMEM126B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
TMEM126B Lysate (NBP2-65578)
Control Peptide
TMEM126B Protein (NBP1-83157PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM126B Antibody

  • HT007
  • MGC111203
  • transmembrane protein 126B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TMEM126B Antibody (NBP1-83157) (0)

There are no publications for TMEM126B Antibody (NBP1-83157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM126B Antibody (NBP1-83157) (0)

There are no reviews for TMEM126B Antibody (NBP1-83157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM126B Antibody (NBP1-83157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TMEM126B Products

Bioinformatics Tool for TMEM126B Antibody (NBP1-83157)

Discover related pathways, diseases and genes to TMEM126B Antibody (NBP1-83157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for TMEM126B Antibody (NBP1-83157)

Find related products by research area.

Blogs on TMEM126B

There are no specific blogs for TMEM126B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM126B Antibody and receive a gift card or discount.


Gene Symbol TMEM126B