TMED3 Antibody

Images

 
Immunohistochemistry-Paraffin: TMED3 Antibody [NBP2-13439] Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMED3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGDEPPILPDMGNRVTALTQRFRGAYWKEVDKMVDYMQPGGTPATEGLGR LAPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMED3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMED3 Protein (NBP2-13439PEP)
Publications
Read Publication using
NBP2-13439 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMED3 Antibody

  • C15orf22
  • chromosome 15 open reading frame 22
  • integral type I protein
  • Membrane protein p24B
  • MGC133022
  • P24B
  • transmembrane emp24 domain containing 3
  • transmembrane emp24 domain-containing protein 3
  • transmembrane emp24 protein transport domain containing 3,1200002G13Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13439
Species: Hu
Applications: IHC, IHC-P

Publications for TMED3 Antibody (NBP2-13439)(1)

Reviews for TMED3 Antibody (NBP2-13439) (0)

There are no reviews for TMED3 Antibody (NBP2-13439). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMED3 Antibody (NBP2-13439) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMED3 Products

Bioinformatics Tool for TMED3 Antibody (NBP2-13439)

Discover related pathways, diseases and genes to TMED3 Antibody (NBP2-13439). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMED3 Antibody (NBP2-13439)

Discover more about diseases related to TMED3 Antibody (NBP2-13439).
 

Pathways for TMED3 Antibody (NBP2-13439)

View related products by pathway.

Blogs on TMED3

There are no specific blogs for TMED3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMED3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMED3