We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TM9SF4 Recombinant Protein Antigen

Images

 
There are currently no images for TM9SF4 Protein (NBP2-32382PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TM9SF4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TM9SF4.

Source: E. coli

Amino Acid Sequence: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TM9SF4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32382.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TM9SF4 Recombinant Protein Antigen

  • KIAA0255dJ836N17.2
  • transmembrane 9 superfamily member 4
  • transmembrane 9 superfamily protein member 4

Background

TM9SF4 is a gene that codes for a multi-pass membrane protein that is 642 amino acids long and weighs approximately 75 kDa. Current studies are being done on diseases and disorders linked to this gene including melanoma and malaria. TM9SF4 has also been shown to have interactions with RAB5A, ARCN1, UBC, HSP90AA1, and ATP13A1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
NBP1-30914
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IM, WB
NBP1-80958
Species: Hu
Applications: IHC,  IHC-P
MAB3915
Species: Hu, Mu
Applications: WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-81930
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-80736
Species: Hu
Applications: ICC/IF,  IHC-P
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP1-62532
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-19882
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for TM9SF4 Protein (NBP2-32382PEP) (0)

There are no publications for TM9SF4 Protein (NBP2-32382PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM9SF4 Protein (NBP2-32382PEP) (0)

There are no reviews for TM9SF4 Protein (NBP2-32382PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TM9SF4 Protein (NBP2-32382PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TM9SF4 Products

Blogs on TM9SF4

There are no specific blogs for TM9SF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TM9SF4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TM9SF4