TIP60 Recombinant Protein Antigen

Images

 
There are currently no images for TIP60 Protein (NBP1-85482PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TIP60 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KAT5.

Source: E. coli

Amino Acid Sequence: KVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KAT5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85482.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIP60 Recombinant Protein Antigen

  • cPLA2
  • ESA1EC 2.3.1.48
  • Histone acetyltransferase HTATIP
  • histone acetyltransferase KAT5
  • HIV-1 Tat interactive protein
  • HIV-1 Tat interactive protein, 60kDa
  • HTATIP
  • HTATIP1
  • HTATIPcPLA2 interacting protein
  • K(lysine) acetyltransferase 5,60 kDa Tat-interactive protein
  • K-acetyltransferase 5
  • KAT5
  • Lysine acetyltransferase 5
  • PLIPTIP
  • Tat interacting protein, 60kDa
  • TIP60
  • TIP60cPLA(2)-interacting protein

Background

HTATIP (HIV-1 Tat interacting protein TIP60, about 60kDa) belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. The nucleosome, made up of four core histone proteins (H2A, H2B, H3 and H4), is the primary building block of chromatin. In addition to the growing number of post-translational histone modifications regulating chromatin structure, cells can also exchange canonical histones with variant histones that can directly or indirectly modulate chromatin structure. There are five major variants of histone H2A: canonical H2A (most abundant), H2A.X, MacroH2A, H2ABbd and H2A.Z. Histone H2A.Z, the most conserved variant across species, functions as both a positive and negative regulator of transcription and is important for chromosome stability. Several homologous protein complexes, such as SWR-C, TIP60 and SRCAP (mammals), have been shown to catalyze the ATP-dependent exchange of H2A.Z for H2A in the nucleosome. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4925
Species: Mu
Applications: IHC, Simple Western, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP3-46465
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-24593
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP3-41287
Species: Hu
Applications: IHC,  IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85482PEP
Species: Hu
Applications: AC

Publications for TIP60 Protein (NBP1-85482PEP) (0)

There are no publications for TIP60 Protein (NBP1-85482PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIP60 Protein (NBP1-85482PEP) (0)

There are no reviews for TIP60 Protein (NBP1-85482PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIP60 Protein (NBP1-85482PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIP60 Products

Research Areas for TIP60 Protein (NBP1-85482PEP)

Find related products by research area.

Blogs on TIP60

There are no specific blogs for TIP60, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TIP60 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT5