Recombinant Human THNSL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human THNSL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 151-250 of Human THNSL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IVYLDVPLLDLICRLKLMKTDRIVGQNSGTSMKDLLKFRRQYYKKWYDARVFCESGASPEEVADKVLNAIKRYQDVDSETFISTRHVWPEDCEQKVSAKF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
THNSL1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human THNSL1 Protein

  • threonine synthase-like 1 (S. cerevisiae)

Background

THNSL1 - threonine synthase-like 1 (bacterial)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-03933
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92629
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4340
Species: Hu, Rt
Applications: WB, IHC
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready

Publications for THNSL1 Partial Recombinant Protein (H00079896-Q01) (0)

There are no publications for THNSL1 Partial Recombinant Protein (H00079896-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THNSL1 Partial Recombinant Protein (H00079896-Q01) (0)

There are no reviews for THNSL1 Partial Recombinant Protein (H00079896-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THNSL1 Partial Recombinant Protein (H00079896-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional THNSL1 Products

Bioinformatics Tool for THNSL1 Partial Recombinant Protein (H00079896-Q01)

Discover related pathways, diseases and genes to THNSL1 Partial Recombinant Protein (H00079896-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for THNSL1 Partial Recombinant Protein (H00079896-Q01)

Find related products by research area.

Blogs on THNSL1

There are no specific blogs for THNSL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

THNSL1 Antibody
NBP1-82130
ALDH1A2 Antibody
NBP1-87158

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human THNSL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THNSL1