Recombinant Human TBRG4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TBRG4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human TBRG4

Source: Wheat Germ

Amino Acid Sequence: MAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBRG4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBRG4 Protein

  • cell cycle progression 2 protein
  • Cell cycle progression protein 2
  • Cell cycle progression restoration protein 2
  • CPR2
  • FAST kinase domains 4
  • FASTKD4Cpr2
  • KIAA0948H_TD2522F11.8
  • protein TBRG4
  • transforming growth factor beta regulator 4FAST kinase domain-containing protein 4

Background

TBRG4 - transforming growth factor beta regulator 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4875
Species: Hu
Applications: WB
NBP1-06519
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56620
Species: Hu
Applications: WB
NLS442
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009238-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TBRG4 Partial Recombinant Protein (H00009238-Q01) (0)

There are no publications for TBRG4 Partial Recombinant Protein (H00009238-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBRG4 Partial Recombinant Protein (H00009238-Q01) (0)

There are no reviews for TBRG4 Partial Recombinant Protein (H00009238-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBRG4 Partial Recombinant Protein (H00009238-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBRG4 Products

Bioinformatics Tool for TBRG4 Partial Recombinant Protein (H00009238-Q01)

Discover related pathways, diseases and genes to TBRG4 Partial Recombinant Protein (H00009238-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TBRG4 Partial Recombinant Protein (H00009238-Q01)

View related products by pathway.

PTMs for TBRG4 Partial Recombinant Protein (H00009238-Q01)

Learn more about PTMs related to TBRG4 Partial Recombinant Protein (H00009238-Q01).
 

Research Areas for TBRG4 Partial Recombinant Protein (H00009238-Q01)

Find related products by research area.

Blogs on TBRG4

There are no specific blogs for TBRG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TBRG4 Antibody
NBP1-85478

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBRG4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBRG4