TBC1D21 Antibody - BSA Free

Immunohistochemistry-Paraffin: TBC1D21 Antibody [NBP1-92479] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TBC1D21 Antibody [NBP1-92479] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: TBC1D21 Antibody [NBP1-92479] - Staining of human testis shows high expression.

Analysis in control (vector only transfected HEK293T lysate) and TBC1D21 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Analysis in human testis and endometrium tissues using Anti-TBC1D21 antibody. Corresponding TBC1D21 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBC1D21 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBC1D21 Antibody - BSA Free (NBP1-92479) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHPFVRTEAWKFLTGYFSWQSSQDER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBC1D21
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TBC1D21 Protein (NBP1-92479PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBC1D21 Antibody - BSA Free

• MGC34741
• TBC1 domain family member 21
• TBC1 domain family, member 21

Background

TBC1D21 may act as a GTPase-activating protein for Rab family protein(s)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBC1D21