Recombinant Human TBC1D19 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TBC1D19 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-526 of Human TBC1D19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLQEESDLSLIIAQIVQKLKGSNLYSQLERQAWASLQRPEIKLESLKEDIKEFFKISGWEKKLQNAVYSELSVFPLPSHPAAPPEHLKEPLVYMRKAQGSWEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMGTDEPDLSLFRPVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKECFVELGLNIGQLGIDDSTQVPPELFENEHVRIGQKVLAEQDSAAAQQYIRQGSPTALRAELWALILNISSQPEDVLYYEQLKTNVIQHDLLVDSLIYKDVKLTASNDDYYFVFEDYLYQVLLCFSRDTSVLSHFAFNSASPPKSYIRGKLGLEEYAVFYPPNGVIPFHGFSMYVAPLCFLYHEPSKLYQIFREMYVRFFFRLHSISSHPSGIVSLCLLFETLLQTYLPQLFYHLREIGAQPLRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILAVLAAAVFAFRAVNLMEVTSLAAAEAVLADLSTLKVMPLLQIFLFATVT

Protein/Peptide Type
Recombinant Protein
Gene
TBC1D19

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBC1D19 Protein

  • FLJ11082
  • TBC1 domain family member 19
  • TBC1 domain family, member 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-45995
Species: Hu
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00055296-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TBC1D19 Recombinant Protein (H00055296-P01) (0)

There are no publications for TBC1D19 Recombinant Protein (H00055296-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D19 Recombinant Protein (H00055296-P01) (0)

There are no reviews for TBC1D19 Recombinant Protein (H00055296-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBC1D19 Recombinant Protein (H00055296-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBC1D19 Products

Bioinformatics Tool for TBC1D19 Recombinant Protein (H00055296-P01)

Discover related pathways, diseases and genes to TBC1D19 Recombinant Protein (H00055296-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D19 Recombinant Protein (H00055296-P01)

Discover more about diseases related to TBC1D19 Recombinant Protein (H00055296-P01).

Blogs on TBC1D19

There are no specific blogs for TBC1D19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TBC1D19 Antibody
NBP1-84600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBC1D19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D19