TAF1D Antibody - BSA Free

Western Blot: TAF1D Antibody [NBP2-85868] - Host: Rabbit. Target Name: TAF1D. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TAF1D Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF1D. Peptide sequence: FEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF1D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TAF1D Antibody - BSA Free

• JOSD3RNA polymerase I-specific TBP-associated factor 41 kDa
• Josephin domain containing 3
• MGC5306
• RAFI41
• TAF(I)41
• TAFI41
• TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa
• TATA box-binding protein-associated factor 1D
• TATA box-binding protein-associated factor RNA polymerase I subunit D
• TBP-associated factor 1D
• Transcription initiation factor SL1/TIF-IB subunit D

Background

TAF1D is a member of the SL1 complex, which includes TBP (MIM 600075) and TAF1A (MIM 604903), TAF1B (MIM 604904), andTAF1C (MIM 604905), and plays a role in RNA polymerase I transcription (Wang et al., 2004 (PubMed 15520167); Gorski etal., 2007 (PubMed 17318177)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF1D