We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

STK33 Recombinant Protein Antigen

Images

 
There are currently no images for STK33 Protein (NBP1-86069PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STK33 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK33.

Source: E. coli

Amino Acid Sequence: KCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK33
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86069.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STK33 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 33
  • serine/threonine-protein kinase 33
  • STK33

Background

Serine/threonine Kinase 33 (STK33) is expressed at high levels in testis and the fetal lung and heart, and at lower levels in a number of other tissues. However, STK33 is different form the other serine/threonine kinases in that it is not expressed in neural tissues. STK33 is thought to be involved in the phosphorylation of vimentin. Additionally, STK33 has been identified as a synthetic lethal in KRAS mutant lung cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-37262
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP3-16802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-93834
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-32343
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-30922
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-35679
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-48144
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
H00091754-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB6028
Species: Hu
Applications: WB

Publications for STK33 Protein (NBP1-86069PEP) (0)

There are no publications for STK33 Protein (NBP1-86069PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK33 Protein (NBP1-86069PEP) (0)

There are no reviews for STK33 Protein (NBP1-86069PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STK33 Protein (NBP1-86069PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STK33 Products

Research Areas for STK33 Protein (NBP1-86069PEP)

Find related products by research area.

Blogs on STK33

There are no specific blogs for STK33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STK33 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK33