SS18L2 Antibody - Azide and BSA Free Summary
| Immunogen |
SS18L2 (AAH17804.1, 1 a.a. - 77 a.a.) full-length human protein. MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYLNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
SS18L2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Immunogen affinity purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SS18L2 Antibody - Azide and BSA Free
Background
Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L2 gene is homologous to SS18.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for SS18L2 Antibody (H00051188-B04P-50ug) (0)
There are no publications for SS18L2 Antibody (H00051188-B04P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SS18L2 Antibody (H00051188-B04P-50ug) (0)
There are no reviews for SS18L2 Antibody (H00051188-B04P-50ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SS18L2 Antibody (H00051188-B04P-50ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SS18L2 Products
Array H00051188-B04P-50ug
Research Areas for SS18L2 Antibody (H00051188-B04P-50ug)
Find related products by research area.
|
Blogs on SS18L2