Reactivity | VSpecies Glossary |
Applications | WB, ELISA |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus Spike RBD (NP_828851.1). Sequence: ADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 139 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol |
Preservative | 0.05% Proclin 300 |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Post-COVID Conditions or Long COVID and COVID Long-Haulers By Jamshed Arslan, Pharm D, PhD Post-acute infection syndrome (PAIS) is a phenomenon where ill effects of an infection persist even after the infection itself is over. PAIS in the case of COVID is called t... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.