Sperm Flagellar 2 Antibody (4B10) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: Sperm Flagellar 2 Antibody (4B10) [H00079925-M01] - Analysis of monoclonal antibody to SPEF2 on HeLa cell . Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Sperm Flagellar 2 Antibody (4B10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Sperm Flagellar 2 Antibody (4B10) - Azide and BSA Free (H00079925-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-Sperm Flagellar 2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FLJ23577 (NP_079143, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY
• Specificity: FLJ23577 - KPL2 protein (4B10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SPEF2
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sperm Flagellar 2 Antibody (4B10) - Azide and BSA Free

• cancer/testis antigen 122
• CT122
• FLJ23164
• FLJ23577
• FLJ25395
• KIAA1770
• KPL2MGC102842
• Protein KPL2
• sperm flagellar 2
• sperm flagellar protein 2

Background

The SPEF2 gene encodes a sperm flagellar protein 2 that exists in four isoforms. Isoform 1 is 1,822 amino acids long at 209 kDA, isoform 2 is 1,818 amino acids long at 209 kDA, isoform 3 is 514 amino acids long at 61 kDA, and isoform 4 is 619 amino acids long at 70 kDA. The protein encoded by the SPEF2 gene is thought to be critical to correct axoneme development. This gene interacts with genes APOA1 and IGHA1. SPEF2 has been linked to diseases such as primary ciliary dyskinesia and infertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sperm Flagellar 2 Antibody (H00079925-M01)(2)

Publications using H00079925-M01

• Sha Y, Liu W, Wei X et al. Biallelic mutations in Sperm flagellum 2 cause human multiple morphological abnormalities of the sperm flagella (MMAF) phenotype Clin. Genet. 2019-07-06 [PMID: 31278745]
• Liu W, Sha Y, Li Y et al. Loss-of-function mutations in SPEF2 cause multiple morphological abnormalities of the sperm flagella (MMAF) J. Med. Genet. 2019-05-31 [PMID: 31151990]

Bioinformatics

• Gene Symbol: SPEF2