SPATA24 Antibody


Western Blot: SPATA24 Antibody [NBP1-70709] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

SPATA24 Antibody Summary

Synthetic peptides corresponding to SPATA24 (spermatogenesis associated 24) The peptide sequence was selected from the c terminal of SPATA24 )(50ug). Peptide sequence LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPATA24 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPATA24 Antibody

  • spermatogenesis associated 24
  • spermatogenesis-associated protein 24


SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.SPATA24 may play a role in cytoplasm movement and removal during spermiogenesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for SPATA24 Antibody (NBP1-70709) (0)

There are no publications for SPATA24 Antibody (NBP1-70709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA24 Antibody (NBP1-70709) (0)

There are no reviews for SPATA24 Antibody (NBP1-70709). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA24 Antibody (NBP1-70709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPATA24 Antibody Products

Related Products by Gene

Bioinformatics Tool for SPATA24 Antibody (NBP1-70709)

Discover related pathways, diseases and genes to SPATA24 Antibody (NBP1-70709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPATA24

There are no specific blogs for SPATA24, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol SPATA24

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-70709 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought