SPATA24 Antibody


Western Blot: SPATA24 Antibody [NBP1-70709] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SPATA24 Antibody Summary

Synthetic peptides corresponding to SPATA24 (spermatogenesis associated 24) The peptide sequence was selected from the c terminal of SPATA24 )(50ug). Peptide sequence LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPATA24 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPATA24 Antibody

  • spermatogenesis associated 24
  • spermatogenesis-associated protein 24


SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.SPATA24 may play a role in cytoplasm movement and removal during spermiogenesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for SPATA24 Antibody (NBP1-70709) (0)

There are no publications for SPATA24 Antibody (NBP1-70709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA24 Antibody (NBP1-70709) (0)

There are no reviews for SPATA24 Antibody (NBP1-70709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA24 Antibody (NBP1-70709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPATA24 Products

Bioinformatics Tool for SPATA24 Antibody (NBP1-70709)

Discover related pathways, diseases and genes to SPATA24 Antibody (NBP1-70709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPATA24

There are no specific blogs for SPATA24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPATA24 Antibody and receive a gift card or discount.


Gene Symbol SPATA24