SPANXN3 Antibody (1F11)

Images

 
Western Blot: SPANXN3 Antibody (1F11) [H00139067-M01] - Analysis of SPANXN3 expression in transfected 293T cell line by SPANXN3 monoclonal antibody (M01), clone 1F11.Lane 1: SPANXN3 transfected lysate (Predicted MW: ...read more
Sandwich ELISA: SPANXN3 Antibody (1F11) [H00139067-M01] - Detection limit for recombinant GST tagged SPANXN3 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPANXN3 Antibody (1F11) Summary

Immunogen
SPANXN3 (NP_001009609.1, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKINSNQLENEQSQENSINPIQKEEDEGVDLSEGSSNEDEDLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGED
Specificity
This product is specific for Human SPANXN3 monoclonal antibody (M01), clone 1F11 [Gene ID: 139067].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPANXN3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Mouse monoclonal antibody raised against a full-length recombinant SPANXN3.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPANXN3 Antibody (1F11)

  • cancer/testis antigen family 11, member 8
  • CT11.8
  • Nuclear-associated protein SPAN-Xn3
  • SPANX family member N3
  • SPANX family, member N3
  • SPANX-N3sperm protein associated with the nucleus on the X chromosome N3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00030014-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-77925
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
H00494119-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-68961
Species: Hu
Applications: IHC, IHC-P
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-68961
Species: Hu
Applications: IHC, IHC-P
H00139067-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for SPANXN3 Antibody (H00139067-M01) (0)

There are no publications for SPANXN3 Antibody (H00139067-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPANXN3 Antibody (H00139067-M01) (0)

There are no reviews for SPANXN3 Antibody (H00139067-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPANXN3 Antibody (H00139067-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPANXN3 Products

Bioinformatics Tool for SPANXN3 Antibody (H00139067-M01)

Discover related pathways, diseases and genes to SPANXN3 Antibody (H00139067-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPANXN3

There are no specific blogs for SPANXN3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPANXN3 Antibody (1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPANXN3
Uniprot