SMYD4 Antibody - BSA Free

Western Blot: SMYD4 Antibody [NBP1-81356] - Analysis in control (vector only transfected HEK293T lysate) and SMYD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: SMYD4 Antibody [NBP1-81356] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, the Golgi apparatus & vesicles.

Immunohistochemistry-Paraffin: SMYD4 Antibody [NBP1-81356] - Staining of human ovary shows cytoplasmic positivity in follicle cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMYD4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SMYD4 Antibody - BSA Free (NBP1-81356) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ACQTEAHRMAAGPRWEAFCCNSCGAPMQGDDVLRCGSRSCAESAVSRDHLVSRLQDLQQQVRVAQKLLRDGELERAVQRLSGCQR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMYD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMYD4 Protein (NBP1-81356PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMYD4 Antibody - BSA Free

• KIAA1936ZMYND21
• SET and MYND domain containing 4
• SET and MYND domain-containing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for SMYD4 Antibody (NBP1-81356). (Showing 1 - 1 of 1 FAQ).

1. I have bought two different antibodies against SMYD4 (from two different companies) and they didn't work specifically. They were unable to detect the human SMYD4 protein that I was over-expressing (neither WB nor IF). Can you send me an aliquot to test your antibody? Do you know if it recognize the mouse Smyd4?
   • I can confirm that the antibody NBP1-81356 was raised against and binds to the human SMYD4. The antibody NBP1-79406 also targets human SMYD4. Please see the images on the website datasheets for these products for validation. We also sell SMYD4 Overexpression Lysate (NBL1-16263), for use as positive control. Unfortunately, I am not able to offer you samples of these products. However, if you use them in Western blot you would be covered by our Novus Guarantee, and if you use a product in an application not mentioned on its datasheet (e.g. ICC) you would be eligible for our Innovators Reward Program.

Bioinformatics

• Gene Symbol: SMYD4
• Entrez:
  • 114826(Human)
• Uniprot:
  • Q8IYR2(Human)