SMPDL3A Antibody

Western Blot: SMPDL3A Antibody [NBP1-74114] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SMPDL3A Antibody Summary

• Immunogen: Synthetic peptides corresponding to the N terminal of Smpdl3a. Immunizing peptide sequence YQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMPDL3A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against Smpdl3a and was validated on Western blot.
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SMPDL3A Antibody

• 0610010C24Rik
• acid sphingomyelinase-like phosphodiesterase 3a
• ASM3A
• ASML3A
• ASM-like phosphodiesterase 3a
• EC 3.1.4
• EC 3.1.4.-
• FLJ20177
• SMPDL3A
• sphingomyelin phosphodiesterase, acid-like 3A
• yR36GH4.1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMPDL3A
• Uniprot:
  • P70158(Mouse)