![Western Blot: SMPDL3A Antibody [NBP1-74114] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%](http://images.novusbio.com/fullsize/SMPDL3A Antibody-Western Blot-NBP1-74114-img0001.jpg "Western Blot: SMPDL3A Antibody [NBP1-74114] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to the N terminal of Smpdl3a.
Immunizing peptide sequence YQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTM. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMPDL3A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against Smpdl3a and was validated on Western blot. |
| Theoretical MW | 49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for SMPDL3A Antibody (NBP1-74114)Discover more about diseases related to SMPDL3A Antibody (NBP1-74114).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: DBC1 Antibody [NBP1-85305] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/DBC1-Antibody-Western-Blot-NBP1-85305-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: DBC1 Antibody [NBP1-85305] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/DBC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85305-img0007.jpg)
![Immunohistochemistry-Paraffin: DBC1 Antibody [NBP1-85305] - Staining in human testis and liver tissues using anti-CCAR2 antibody. Corresponding CCAR2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/DBC1-Antibody-Immunohistochemistry-Paraffin-NBP1-85305-img0010.jpg)
![Western Blot: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SMPD1.](http://images.novusbio.com/fullsize2/SMPD1 Antibody (3H7)-Western Blot-NBP2-45889-img0022.jpg)
![Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)](http://images.novusbio.com/fullsize2/SMPD1-Antibody-(3H7)-Immunohistochemistry-NBP2-45889-img0021.jpg)
![Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)](http://images.novusbio.com/fullsize2/SMPD1-Antibody-(3H7)-Immunohistochemistry-NBP2-45889-img0001.jpg)
![Western Blot: DBC1/p30 Antibody [NBP2-22294] - Whole cell lysate (50 ug) from NIH3T3, Renca, and TCMK-1 cells. NBP2-22294 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/DBC1-p30-Antibody-Western-Blot-NBP2-22294-img0002.jpg)
![Immunohistochemistry: DBC1/p30 Antibody [NBP2-22294] - Sample: FFPE section of mouse teratoma. Antibody: Affinity purified rabbit anti- BC1/p30 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).](http://images.novusbio.com/fullsize2/DBC1-p30-Antibody-Immunohistochemistry-NBP2-22294-img0010.jpg)
![Western Blot: DBC1/p30 Antibody [NBP2-22294] - Whole cell lysate from 293T (15 and 50 ug), HeLa (50 ug), and Jurkat (50 ug) cells. NBP2-22294 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/DBC1-p30-Antibody-Western-Blot-NBP2-22294-img0001.jpg)
![Western Blot: LXR Antibody [NB400-157] - WB detection of LXR in human liver.](http://images.novusbio.com/fullsize2/LXR-Antibody-Western-Blot-NB400-157-img0001.jpg)
![Simple Western: LXR Antibody [NB400-157] - Simple Western lane view shows a ~49 kDa for LXR in human skeletal muscle tissue lysate under reducing conditions. Image from verified customer review.](http://images.novusbio.com/fullsize2/LXR-Antibody-Simple-Western-NB400-157-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")
