SMPDL3A Antibody


Western Blot: SMPDL3A Antibody [NBP1-74114] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

SMPDL3A Antibody Summary

Synthetic peptides corresponding to the N terminal of Smpdl3a. Immunizing peptide sequence YQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTM. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Smpdl3a and was validated on Western blot.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SMPDL3A Antibody

  • 0610010C24Rik
  • acid sphingomyelinase-like phosphodiesterase 3a
  • ASM3A
  • ASML3A
  • ASM-like phosphodiesterase 3a
  • EC 3.1.4
  • EC 3.1.4.-
  • FLJ20177
  • sphingomyelin phosphodiesterase, acid-like 3A
  • yR36GH4.1


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-Fr, WB

Publications for SMPDL3A Antibody (NBP1-74114) (0)

There are no publications for SMPDL3A Antibody (NBP1-74114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMPDL3A Antibody (NBP1-74114) (0)

There are no reviews for SMPDL3A Antibody (NBP1-74114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMPDL3A Antibody (NBP1-74114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SMPDL3A Products

Bioinformatics Tool for SMPDL3A Antibody (NBP1-74114)

Discover related pathways, diseases and genes to SMPDL3A Antibody (NBP1-74114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMPDL3A Antibody (NBP1-74114)

Discover more about diseases related to SMPDL3A Antibody (NBP1-74114).

Blogs on SMPDL3A

There are no specific blogs for SMPDL3A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SMPDL3A Antibody and receive a gift card or discount.


Gene Symbol SMPDL3A