SMCO1 Antibody

Images

 
Immunohistochemistry-Paraffin: SMCO1 Antibody [NBP2-32354] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMCO1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMCO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SMCO1 Protein (NBP2-32354PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMCO1 Antibody

  • C3orf43
  • Chromosome 3 Open Reading Frame 43
  • Single-Pass Membrane And Coiled-Coil Domain-Containing Protein 1
  • Single-Pass Membrane Protein With Coiled-Coil Domains 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMCO1 Antibody (NBP2-32354) (0)

There are no publications for SMCO1 Antibody (NBP2-32354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMCO1 Antibody (NBP2-32354) (0)

There are no reviews for SMCO1 Antibody (NBP2-32354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SMCO1 Antibody (NBP2-32354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMCO1 Products

Array NBP2-32354

Bioinformatics Tool for SMCO1 Antibody (NBP2-32354)

Discover related pathways, diseases and genes to SMCO1 Antibody (NBP2-32354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SMCO1

There are no specific blogs for SMCO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMCO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMCO1