SLFN12 Antibody

Immunohistochemistry-Paraffin: SLFN12 Antibody [NBP2-48557] - Staining of human Pancreas shows moderate membranous positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: SLFN12 Antibody [NBP2-48557] - Staining of human Cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: SLFN12 Antibody [NBP2-48557] - Staining of human Cerebral cortex shows strong cytoplasmic positivity in endothelial cells.

Immunohistochemistry-Paraffin: SLFN12 Antibody [NBP2-48557] - Staining of human Skeletal muscle shows moderate membranous positivity in myocytes.

Product Discontinued

SLFN12 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NRVMQLTRKEWIQFMVEAEPKFSSSYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLFN12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLFN12 Antibody

• schlafen family member 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLFN12