SLC35E1 Antibody


Western Blot: SLC35E1 Antibody [NBP1-94009] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunocytochemistry/ Immunofluorescence: SLC35E1 Antibody [NBP1-94009] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC35E1 Antibody [NBP1-94009] - Staining of human kidney shows cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SLC35E1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC35E1 Protein (NBP1-94009PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC35E1 Antibody

  • FLJ14251
  • FLJ36689
  • solute carrier family 35 member E1
  • solute carrier family 35, member E1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, WB

Publications for SLC35E1 Antibody (NBP1-94009) (0)

There are no publications for SLC35E1 Antibody (NBP1-94009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35E1 Antibody (NBP1-94009) (0)

There are no reviews for SLC35E1 Antibody (NBP1-94009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC35E1 Antibody (NBP1-94009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC35E1 Products

Bioinformatics Tool for SLC35E1 Antibody (NBP1-94009)

Discover related pathways, diseases and genes to SLC35E1 Antibody (NBP1-94009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35E1 Antibody (NBP1-94009)

Discover more about diseases related to SLC35E1 Antibody (NBP1-94009).

Pathways for SLC35E1 Antibody (NBP1-94009)

View related products by pathway.

Blogs on SLC35E1

There are no specific blogs for SLC35E1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC35E1 Antibody and receive a gift card or discount.


Gene Symbol SLC35E1