Recombinant Human SLC25A38 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC25A38 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-304 of Human SLC25A38 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKMGLKS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLC25A38
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A38 Protein

  • FLJ20551
  • FLJ22703
  • solute carrier family 25 member 38
  • solute carrier family 25, member 38

Background

SLC25A38 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000212-M01
Species: Hu, Mu
Applications: WB, ELISA
NBP2-30976
Species: Hu
Applications: IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-59607
Species: Hu
Applications: WB
NBP1-86944
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13324
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-45519
Species: Hu
Applications: WB, IHC
NBP2-13325
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89313
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80527
Species: Hu
Applications: WB
NBP2-58085
Species: Hu
Applications: WB, ICC/IF
NBP1-93525
Species: Hu
Applications: IHC, IHC-P
NBP1-93778
Species: Hu
Applications: IHC, IHC-P
H00054977-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC25A38 Recombinant Protein (H00054977-P01) (0)

There are no publications for SLC25A38 Recombinant Protein (H00054977-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A38 Recombinant Protein (H00054977-P01) (0)

There are no reviews for SLC25A38 Recombinant Protein (H00054977-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A38 Recombinant Protein (H00054977-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC25A38 Products

Bioinformatics Tool for SLC25A38 Recombinant Protein (H00054977-P01)

Discover related pathways, diseases and genes to SLC25A38 Recombinant Protein (H00054977-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A38 Recombinant Protein (H00054977-P01)

Discover more about diseases related to SLC25A38 Recombinant Protein (H00054977-P01).
 

Pathways for SLC25A38 Recombinant Protein (H00054977-P01)

View related products by pathway.

Blogs on SLC25A38

There are no specific blogs for SLC25A38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A38 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A38