SFT2D1 Antibody


Immunocytochemistry/ Immunofluorescence: SFT2D1 Antibody [NBP1-86737] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: SFT2D1 Antibody [NBP1-86737] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SFT2D1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRL
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SFT2D1 Protein (NBP1-86737PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SFT2D1 Antibody

  • C6orf83
  • MGC19825
  • pRGR1chromosome 6 open reading frame 83
  • SFT2 domain containing 1
  • SFT2 domain-containing protein 1
  • vesicle transport protein SFT2A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SFT2D1 Antibody (NBP1-86737) (0)

There are no publications for SFT2D1 Antibody (NBP1-86737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFT2D1 Antibody (NBP1-86737) (0)

There are no reviews for SFT2D1 Antibody (NBP1-86737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SFT2D1 Antibody (NBP1-86737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SFT2D1 Products

Array NBP1-86737

Bioinformatics Tool for SFT2D1 Antibody (NBP1-86737)

Discover related pathways, diseases and genes to SFT2D1 Antibody (NBP1-86737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFT2D1

There are no specific blogs for SFT2D1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SFT2D1 Antibody and receive a gift card or discount.


Gene Symbol SFT2D1