We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Septin-12 Antibody - BSA Free

Images

 
Western Blot: Septin-12 Antibody [NBP1-91640] - Analysis in control (vector only transfected HEK293T lysate) and LY408232 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: Septin-12 Antibody [NBP1-91640] - Staining of human cell line U-2 OS shows localization to microtubules. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Septin-12 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPTIN12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Septin-12 Antibody - BSA Free

  • FLJ25410
  • septin 12
  • septin-12

Background

Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia (Hall et al., 2005 [PubMed 15915442]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00124404-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00151011-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-41402
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Septin-12 Antibody (NBP1-91640) (0)

There are no publications for Septin-12 Antibody (NBP1-91640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-12 Antibody (NBP1-91640) (0)

There are no reviews for Septin-12 Antibody (NBP1-91640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Septin-12 Antibody (NBP1-91640). (Showing 1 - 1 of 1 FAQ).

  1. I'm interested in Septin-12 Antibody (NBP1-91640) for IHC-P. I wonder if 1:500 works well on IHC-P, taking into consideration of dilution factor for ICC and IHC.
    • Septin-12 is widely expressed in various normal and cancerous tissues, however, its expression levels vary from tissue to tissue. For example, its highest expression levels are seen in lymph node, colon, heart, testes, placenta etc. whereas weak to moderate expression may be seen in liver, brain, bronchus, skin etc. Its expression is negligible in spleen, ovary and breasts, and this is the reason you see a wide range of dilutions being suggested for different applications which also have different levels of sensitivity with respect to detection of a given target. In our validation testing for IHC-P staining of human stomach, this antibody worked well at a dilution of 1:500-1:1000 range, however, we suggest you to optimize the best suitable dilution for your assay from your own pilot testing.

Secondary Antibodies

 

Isotype Controls

Additional Septin-12 Products

Research Areas for Septin-12 Antibody (NBP1-91640)

Find related products by research area.

Blogs on Septin-12

There are no specific blogs for Septin-12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-12 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPTIN12