Septin-12 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Septin-12 Antibody - BSA Free (NBP1-91640) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SEPT12 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Septin-12 Antibody - BSA Free
Background
Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia (Hall et al., 2005 [PubMed 15915442]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF
Publications for Septin-12 Antibody (NBP1-91640) (0)
There are no publications for Septin-12 Antibody (NBP1-91640).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Septin-12 Antibody (NBP1-91640) (0)
There are no reviews for Septin-12 Antibody (NBP1-91640).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Septin-12 Antibody (NBP1-91640). (Showing 1 - 1 of 1 FAQ).
-
I'm interested in Septin-12 Antibody (NBP1-91640) for IHC-P. I wonder if 1:500 works well on IHC-P, taking into consideration of dilution factor for ICC and IHC.
- Septin-12 is widely expressed in various normal and cancerous tissues, however, its expression levels vary from tissue to tissue. For example, its highest expression levels are seen in lymph node, colon, heart, testes, placenta etc. whereas weak to moderate expression may be seen in liver, brain, bronchus, skin etc. Its expression is negligible in spleen, ovary and breasts, and this is the reason you see a wide range of dilutions being suggested for different applications which also have different levels of sensitivity with respect to detection of a given target. In our validation testing for IHC-P staining of human stomach, this antibody worked well at a dilution of 1:500-1:1000 range, however, we suggest you to optimize the best suitable dilution for your assay from your own pilot testing.
Secondary Antibodies
| |
Isotype Controls
|
Additional Septin-12 Products
Research Areas for Septin-12 Antibody (NBP1-91640)
Find related products by research area.
|
Blogs on Septin-12