Septin-12 Antibody - BSA Free

Western Blot: Septin-12 Antibody [NBP1-91640] - Analysis in control (vector only transfected HEK293T lysate) and LY408232 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Septin-12 Antibody [NBP1-91640] - Staining of human cell line U-2 OS shows localization to microtubules. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Septin-12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Septin-12 Antibody - BSA Free (NBP1-91640) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEPT12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Septin-12 Antibody - BSA Free

• FLJ25410
• septin 12
• septin-12

Background

Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia (Hall et al., 2005 [PubMed 15915442]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Septin-12 Antibody (NBP1-91640). (Showing 1 - 1 of 1 FAQ).

1. I'm interested in Septin-12 Antibody (NBP1-91640) for IHC-P. I wonder if 1:500 works well on IHC-P, taking into consideration of dilution factor for ICC and IHC.
   • Septin-12 is widely expressed in various normal and cancerous tissues, however, its expression levels vary from tissue to tissue. For example, its highest expression levels are seen in lymph node, colon, heart, testes, placenta etc. whereas weak to moderate expression may be seen in liver, brain, bronchus, skin etc. Its expression is negligible in spleen, ovary and breasts, and this is the reason you see a wide range of dilutions being suggested for different applications which also have different levels of sensitivity with respect to detection of a given target. In our validation testing for IHC-P staining of human stomach, this antibody worked well at a dilution of 1:500-1:1000 range, however, we suggest you to optimize the best suitable dilution for your assay from your own pilot testing.

Bioinformatics

• Gene Symbol: SEPT12