SARS-CoV-2 nsp8 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of coronavirus NSP8 (YP_009742615.1). AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ORF1ab |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:2000 - 1:10000
|
Theoretical MW |
141 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for SARS-CoV-2 nsp8 Antibody - Azide and BSA Free
Background
SARS-CoV-2 Nonstructural Protein 8 (NSP8) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP8 is 198 amino acids (aa) with a theoretical molecular weight of 21.9 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP8 has 97.5% sequence identity and 100% sequence similarity (1). SARS-CoV-2 NSP8 heterodimerizes with NSP7, which forms a complex with NSP12 (1-4). NSP8 alone in its monomeric form can also complex with NSP12, generating the RNA polymerase complex (1,4). Additionally, NSP8 is shown to interact with the SARS-CoV-2 open reading frame 6 (ORF6), encouraging RNA polymerase activity (1).
References
1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4
2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9
3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39
4. Peng, Q., Peng, R., Yuan, B., Zhao, J., Wang, M., Wang, X., Wang, Q., Sun, Y., Fan, Z., Qi, J., Gao, G. F., & Shi, Y. (2020). Structural and Biochemical Characterization of the nsp12-nsp7-nsp8 Core Polymerase Complex from SARS-CoV-2. Cell reports. https://doi.org/10.1016/j.celrep.2020.107774
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SARS-CoV-2 nsp8 Antibody (NBP3-15980) (0)
There are no publications for SARS-CoV-2 nsp8 Antibody (NBP3-15980).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SARS-CoV-2 nsp8 Antibody (NBP3-15980) (0)
There are no reviews for SARS-CoV-2 nsp8 Antibody (NBP3-15980).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS-CoV-2 nsp8 Antibody (NBP3-15980) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SARS-CoV-2 nsp8 Products
Blogs on SARS-CoV-2 nsp8