RRP15 Antibody


Western Blot: RRP15 Antibody [NBP1-84522] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-493
Immunocytochemistry/ Immunofluorescence: RRP15 Antibody [NBP1-84522] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
Immunohistochemistry-Paraffin: RRP15 Antibody [NBP1-84522] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RRP15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
Specificity of human RRP15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RRP15 Protein (NBP1-84522PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RRP15 Antibody

  • CGI-115
  • KIAA0507Ribosomal RNA-processing protein 15
  • MGC22291
  • ribosomal RNA processing 15 homolog (S. cerevisiae)
  • RRP15-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IP (-), WB, IP, PLA, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RRP15 Antibody (NBP1-84522) (0)

There are no publications for RRP15 Antibody (NBP1-84522).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRP15 Antibody (NBP1-84522) (0)

There are no reviews for RRP15 Antibody (NBP1-84522). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RRP15 Antibody (NBP1-84522) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RRP15 Products

Bioinformatics Tool for RRP15 Antibody (NBP1-84522)

Discover related pathways, diseases and genes to RRP15 Antibody (NBP1-84522). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RRP15 Antibody (NBP1-84522)

View related products by pathway.

Blogs on RRP15

There are no specific blogs for RRP15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RRP15 Antibody and receive a gift card or discount.


Gene Symbol RRP15