RNF212 Antibody (5H3)

Images

 
Western Blot: RNF212 Antibody (5H3) [H00285498-M01] - Analysis of RNF212 expression in transfected 293T cell line by RNF212 monoclonal antibody (M01), clone 5H3.Lane 1: RNF212 transfected lysate (Predicted MW: 33.4 ...read more
Immunocytochemistry/ Immunofluorescence: RNF212 Antibody (5H3) [H00285498-M01] - Analysis of monoclonal antibody to RNF212 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: RNF212 Antibody (5H3) [H00285498-M01] - Detection limit for recombinant GST tagged RNF212 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF212 Antibody (5H3) Summary

Immunogen
LOC285498 (NP_919420, 133 a.a. ~ 233 a.a) partial recombinant protein with GST tag.IKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIA AGPARISMISPPQDGRMAPCARRVCHFQRFTMFLHRRLSSLA APPSVQFWKARGTHQL
Specificity
LOC285498 - hypothetical protein LOC285498
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNF212
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF212 Antibody (5H3)

  • FLJ38841
  • FLJ42587
  • hypothetical protein LOC285498
  • MGC120227
  • MGC120228
  • ring finger protein 212
  • ZHP3

Background

Contains 1 RING-type zinc finger.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80118
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03897
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
H00007357-M03
Species: Hu
Applications: WB, ELISA

Publications for RNF212 Antibody (H00285498-M01) (0)

There are no publications for RNF212 Antibody (H00285498-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF212 Antibody (H00285498-M01) (0)

There are no reviews for RNF212 Antibody (H00285498-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF212 Antibody (H00285498-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF212 Products

Bioinformatics Tool for RNF212 Antibody (H00285498-M01)

Discover related pathways, diseases and genes to RNF212 Antibody (H00285498-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF212 Antibody (H00285498-M01)

Discover more about diseases related to RNF212 Antibody (H00285498-M01).
 

Pathways for RNF212 Antibody (H00285498-M01)

View related products by pathway.

Blogs on RNF212

There are no specific blogs for RNF212, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF212 Antibody (5H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF212
Entrez
Uniprot