RNF170 Antibody

Images

 
Western Blot: RNF170 Antibody [NBP1-59390] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

RNF170 Antibody Summary

Immunogen
Synthetic peptides corresponding to RNF170(ring finger protein 170) The peptide sequence was selected from the C terminal of RNF170. Peptide sequence FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR.
Clonality
Polyclonal
Host
Rabbit
Gene
RNF170
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RNF170 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF170 Antibody

  • DKFZP564A022
  • FLJ38306
  • Putative LAG1-interacting protein
  • ring finger protein 170

Background

RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88539
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90660
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RNF170 Antibody (NBP1-59390) (0)

There are no publications for RNF170 Antibody (NBP1-59390).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF170 Antibody (NBP1-59390) (0)

There are no reviews for RNF170 Antibody (NBP1-59390). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF170 Antibody (NBP1-59390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF170 Antibody Products

Related Products by Gene

Bioinformatics Tool for RNF170 Antibody (NBP1-59390)

Discover related pathways, diseases and genes to RNF170 Antibody (NBP1-59390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF170 Antibody (NBP1-59390)

Discover more about diseases related to RNF170 Antibody (NBP1-59390).
 

Pathways for RNF170 Antibody (NBP1-59390)

View related products by pathway.

PTMs for RNF170 Antibody (NBP1-59390)

Learn more about PTMs related to RNF170 Antibody (NBP1-59390).
 

Research Areas for RNF170 Antibody (NBP1-59390)

Find related products by research area.

Blogs on RNF170

There are no specific blogs for RNF170, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RNF170
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59390 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

RNF170 Recombinant Protein
H00081790-P01-10ug
RNF170 RNAi
H00081790-R01-20nmol