RNF170 Antibody (NBP1-59390)

Images

 
Western Blot: RNF170 Antibody [NBP1-59390] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF170 Antibody Summary

Immunogen
Synthetic peptides corresponding to RNF170(ring finger protein 170) The peptide sequence was selected from the C terminal of RNF170. Peptide sequence FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF170
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RNF170 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF170 Antibody

  • DKFZP564A022
  • FLJ38306
  • Putative LAG1-interacting protein
  • ring finger protein 170

Background

RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88539
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90660
Species: Hu
Applications: IHC, IHC-P

Publications for RNF170 Antibody (NBP1-59390) (0)

There are no publications for RNF170 Antibody (NBP1-59390).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF170 Antibody (NBP1-59390) (0)

There are no reviews for RNF170 Antibody (NBP1-59390). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF170 Antibody (NBP1-59390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF170 Antibody Products

Related Products by Gene

Bioinformatics Tool for RNF170 Antibody (NBP1-59390)

Discover related pathways, diseases and genes to RNF170 Antibody (NBP1-59390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF170 Antibody (NBP1-59390)

Discover more about diseases related to RNF170 Antibody (NBP1-59390).
 

Pathways for RNF170 Antibody (NBP1-59390)

View related products by pathway.

PTMs for RNF170 Antibody (NBP1-59390)

Learn more about PTMs related to RNF170 Antibody (NBP1-59390).
 

Research Areas for RNF170 Antibody (NBP1-59390)

Find related products by research area.

Blogs on RNF170

There are no specific blogs for RNF170, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF170 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF170
Uniprot

Customers Who Bought This Also Bought