![Immunocytochemistry/Immunofluorescence: RNF145 Antibody [NBP1-82012] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.](http://images.novusbio.com/fullsize2/RNF145 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82012-img0004.jpg "Immunocytochemistry/Immunofluorescence: RNF145 Antibody [NBP1-82012] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA |
| Specificity | Specificity of human RNF145 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNF145 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for RNF145 Antibody (NBP1-82012)Discover more about diseases related to RNF145 Antibody (NBP1-82012).
|
Research Areas for RNF145 Antibody (NBP1-82012)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNF145 |
![Immunohistochemistry-Paraffin: RNF145 Antibody [NBP1-82012] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize2/RNF145-Antibody-Immunohistochemistry-Paraffin-NBP1-82012-img0002.jpg "Immunohistochemistry-Paraffin: RNF145 Antibody [NBP1-82012] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.")
![Immunocytochemistry/Immunofluorescence: Myosin 5a Antibody [NBP1-92156] - Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center & focal adhesion sites. Antibody staining shown in green.](http://images.novusbio.com/fullsize2/Myosin-5a-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92156-img0005.jpg)
![Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize2/Myosin-5a-Antibody-Immunohistochemistry-Paraffin-NBP1-92156-img0002.jpg)
![Western Blot: Fbx32 Antibody [NBP1-79517] - Mouse heart lysate, 1 ug/ml](http://images.novusbio.com/fullsize2/Fbx32-Antibody-Western-Blot-NBP1-79517-img0003.jpg)
![Western Blot: REEP1 Antibody (S345-51) [NBP2-59312] - Analysis of Rat Brain showing detection of ~22 kDa REEP1 protein using Mouse Anti-REEP1 Monoclonal Antibody, Clone S345-51. Lane 1: MW Ladder. Lane 2: Rat Brain. Load: 20 ug. Block: 2% GE Healthcare Blocker for 1 hour at RT. Primary Antibody: Mouse Anti-REEP1 Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: ~22 kDa.](http://images.novusbio.com/fullsize2/REEP1-Antibody-(S345-51)-Western-Blot-NBP2-59312-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: REEP1 Antibody (S345-51) [NBP2-59312] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-REEP1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000; 1:5000 for 60 min RT, 5 min RT. Localization: Cytoplasm, Nucleus. Magnification: 60X.](http://images.novusbio.com/fullsize2/REEP1-Antibody-(S345-51)-Immunocytochemistry-Immunofluorescence-NBP2-59312-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")