RNA binding motif protein, X-linked 2 Antibody - BSA Free

Western Blot: RNA binding motif protein, X-linked 2 Antibody [NBP2-83453] - Host: Rabbit. Target Name: RBMX2. Sample Tissue: Human HCT15 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RNA binding motif protein, X-linked 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RNA binding motif protein, X-linked 2 Antibody - BSA Free (NBP2-83453) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNA binding motif protein, X-linked 2. Peptide sequence: KDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBMX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RNA binding motif protein, X-linked 2 Antibody - BSA Free

• CGI-79,2810411A03Rik
• RNA binding motif protein, X-linked 2
• RNA-binding motif protein, X-linked 2

Background

RBMX2 (RNA-binding motif protein X-linked 2) is an RRM domain containing protein. The function of RBMX2 has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBMX2