Recombinant Human RIC8A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RIC8A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 462-534 of Human RIC8A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RIC8A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RIC8A Protein

  • RIC8
  • RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
  • synembryn
  • synembryn-A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13232
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56179
Species: Hu
Applications: ICC/IF
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu

Publications for RIC8A Partial Recombinant Protein (H00060626-Q01) (0)

There are no publications for RIC8A Partial Recombinant Protein (H00060626-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIC8A Partial Recombinant Protein (H00060626-Q01) (0)

There are no reviews for RIC8A Partial Recombinant Protein (H00060626-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIC8A Partial Recombinant Protein (H00060626-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIC8A Products

Bioinformatics Tool for RIC8A Partial Recombinant Protein (H00060626-Q01)

Discover related pathways, diseases and genes to RIC8A Partial Recombinant Protein (H00060626-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIC8A Partial Recombinant Protein (H00060626-Q01)

Discover more about diseases related to RIC8A Partial Recombinant Protein (H00060626-Q01).
 

Pathways for RIC8A Partial Recombinant Protein (H00060626-Q01)

View related products by pathway.

Blogs on RIC8A

There are no specific blogs for RIC8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GEF-H1 Antibody
NBP2-21577
RIC8A Antibody
NBP2-47304
SUCLG1 Antibody
NBP1-89489

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RIC8A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RIC8A