RGS19 Antibody - BSA Free

Western Blot: RGS19 Antibody [NBP2-88150] - WB Suggested Anti-RGS19 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human brain

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RGS19 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RGS19 Antibody - BSA Free (NBP2-88150) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RGS19. Peptide sequence: HDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RGS19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RGS19 Antibody - BSA Free

• G alpha interacting protein
• GAIPG protein signalling regulator 19
• G-alpha-interacting protein
• GNAI3IP
• guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein
• regulator of G-protein signaling 19
• regulator of G-protein signalling 19
• RGSGAIP

Background

G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.; FUNCTION: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G-alpha subfamily 1 members, with the order G(i)a3 > G(i)a1 > G(o)a >> G(z)a/G(i)a2. Activity on G(z)-alpha is inhibited by phosphorylation and palmitoylation of the G-protein. SUBCELLULAR LOCATION: Membrane; Lipid-anchor. TISSUE SPECIFICITY: Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RGS19