RELL2 Antibody

Western Blot: RELL2 Antibody [NBP3-10023] - Western blot analysis of RELL2 in Human 721_B lymphoblast Whole Cell lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RELL2 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RELL2 (NP_001123501.1). Peptide sequence RYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPER
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RELL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS buffer, 2% sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for RELL2 Antibody

• C5orf16
• chromosome 5 open reading frame 16
• FLJ90583
• receptor expressed in lymphoid tissues like 2
• RELT-like 2
• RELT-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RELL2