| Reactivity | HuSpecies Glossary |
| Applications | Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RANBP3L Antibody - BSA Free (NBP2-38347) is a polyclonal antibody validated for use in IHC and Simple Western. Anti-RANBP3L Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ISVQLSTNQDFLGATSVGCQPNEDKCSFKSCSSNFVFGENMVERVLGTQKLTQPQLENDSYAKEKPFKSIPKFPVNFLSSRTDSIK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RANBP3L |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in Brain, separated by Size, antibody dilution of 1:20 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-38347 | Applications | Species |
|---|---|---|
| Li J, Jaiswal MK, Chien JF et al. Divergent single cell transcriptome and epigenome alterations in ALS and FTD patients with C9orf72 mutation Nat Commun 2023-09-15 [PMID: 37714849] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.