PRSS35 Antibody

Western Blot: PRSS35 Antibody [NBP1-86756] - Analysis in control (vector only transfected HEK293T lysate) and PRSS35 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: PRSS35 Antibody [NBP1-86756] - Staining of human kidney shows strong membranous positivity in cells in tubules with distinct extracellular material.

Product Discontinued

PRSS35 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VSDESNDLLYQYCDAESGSTGSGVYLRLKDPDKKNWKRKIIAVYSGHQWVDVHGVQKDYNVAVRITPL
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRSS35
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PRSS35 Antibody

• C6orf158
• chromosome 6 open reading frame 158
• dJ223E3.1
• EC 3.4.21
• EC 3.4.21.4
• inactive serine protease 35
• MGC46520
• protease, serine, 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRSS35