PRSS35 Antibody

Images

 
Western Blot: PRSS35 Antibody [NBP1-86756] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: PRSS35 Antibody [NBP1-86756] - Staining of human kidney shows strong membranous positivity in cells in tubules with distinct extracellular material.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRSS35 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VSDESNDLLYQYCDAESGSTGSGVYLRLKDPDKKNWKRKIIAVYSGHQWVDVHGVQKDYNVAVRITPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRSS35 Protein (NBP1-86756PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRSS35 Antibody

  • C6orf158
  • chromosome 6 open reading frame 158
  • dJ223E3.1
  • EC 3.4.21
  • EC 3.4.21.4
  • inactive serine protease 35
  • MGC46520
  • protease, serine, 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
NBP1-79488
Species: Hu
Applications: WB
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-79488
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-233
Species: Hu
Applications: WB, PLA

Publications for PRSS35 Antibody (NBP1-86756) (0)

There are no publications for PRSS35 Antibody (NBP1-86756).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRSS35 Antibody (NBP1-86756) (0)

There are no reviews for PRSS35 Antibody (NBP1-86756). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRSS35 Antibody (NBP1-86756) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRSS35 Products

Bioinformatics Tool for PRSS35 Antibody (NBP1-86756)

Discover related pathways, diseases and genes to PRSS35 Antibody (NBP1-86756). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRSS35 Antibody (NBP1-86756)

Discover more about diseases related to PRSS35 Antibody (NBP1-86756).
 

Pathways for PRSS35 Antibody (NBP1-86756)

View related products by pathway.

Blogs on PRSS35

There are no specific blogs for PRSS35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRSS35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS35