Recombinant Human PRR4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRR4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 17-116 of Human PRR4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEAS

Protein/Peptide Type
Partial Recombinant Protein
Gene
PRR4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRR4 Protein

  • DKFZp779L1763
  • Lacrimal proline-rich protein
  • LPRPlacrimal proline rich protein
  • Nasopharyngeal carcinoma-associated proline-rich protein 4
  • PROL4nasopharyngeal carcinoma-associated proline rich 4
  • proline rich 4 (lacrimal)
  • proline-rich polypeptide 4
  • proline-rich protein 4

Background

Lacrimal proline rich protein is a member of the proline-rich protein family which lacks a conserved repetitive domain. It may have a role in protective functions in the eye. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
AF2659
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00010879-T01
Species: Hu
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
H00003346-T01
Species: Hu
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
NBP2-55986
Species: Hu
Applications: ICC/IF
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38045
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PRR4 Partial Recombinant Protein (H00011272-Q01) (0)

There are no publications for PRR4 Partial Recombinant Protein (H00011272-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRR4 Partial Recombinant Protein (H00011272-Q01) (0)

There are no reviews for PRR4 Partial Recombinant Protein (H00011272-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRR4 Partial Recombinant Protein (H00011272-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRR4 Products

Bioinformatics Tool for PRR4 Partial Recombinant Protein (H00011272-Q01)

Discover related pathways, diseases and genes to PRR4 Partial Recombinant Protein (H00011272-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRR4 Partial Recombinant Protein (H00011272-Q01)

Discover more about diseases related to PRR4 Partial Recombinant Protein (H00011272-Q01).

Blogs on PRR4

There are no specific blogs for PRR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRR4 Antibody
NBP1-81289

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRR4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRR4