Recombinant Human Proprotein convertase PC4 Protein

Images

 
Recombinant Human Proprotein convertase PC4 Protein [H00054760-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Proprotein convertase PC4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-242 of Human PCSK4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PCSK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
52.36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Proprotein convertase PC4 Protein

  • DKFZp434B217
  • EC 3.4.21
  • EC 3.4.21.75
  • EC 3.4.21.93
  • MGC34749
  • PC4EC 3.4.21.-
  • Proprotein convertase 4
  • proprotein convertase subtilisin/kexin type 4
  • SPC5

Background

PCSK4( AAH36354, 1 a.a. - 243 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-816
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP, B/N
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
2984-SE
Species: Hu
NBP2-46587
Species: Hu
Applications: WB, IHC
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-82454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
AF6380
Species: Mu
Applications: WB
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF

Publications for Proprotein convertase PC4 Recombinant Protein (H00054760-P01) (0)

There are no publications for Proprotein convertase PC4 Recombinant Protein (H00054760-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proprotein convertase PC4 Recombinant Protein (H00054760-P01) (0)

There are no reviews for Proprotein convertase PC4 Recombinant Protein (H00054760-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proprotein convertase PC4 Recombinant Protein (H00054760-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Proprotein convertase PC4 Recombinant Protein (H00054760-P01)

Discover related pathways, diseases and genes to Proprotein convertase PC4 Recombinant Protein (H00054760-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proprotein convertase PC4 Recombinant Protein (H00054760-P01)

Discover more about diseases related to Proprotein convertase PC4 Recombinant Protein (H00054760-P01).
 

Pathways for Proprotein convertase PC4 Recombinant Protein (H00054760-P01)

View related products by pathway.

PTMs for Proprotein convertase PC4 Recombinant Protein (H00054760-P01)

Learn more about PTMs related to Proprotein convertase PC4 Recombinant Protein (H00054760-P01).

Blogs on Proprotein convertase PC4

There are no specific blogs for Proprotein convertase PC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Furin Antibody
NB100-1903

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Proprotein convertase PC4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK4