Proline rich 16 Antibody - Azide and BSA Free

Western Blot: Proline rich 16 Antibody [NBP3-15526] - Western blot analysis of extracts of various cell lines, using Proline rich 16 Rabbit pAb (NBP3-15526) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Proline rich 16 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Proline rich 16 Antibody - Azide and BSA Free (NBP3-15526) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Proline rich 16 (NP_001295016.1). PNPPPPPPRLTPVKCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRR16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Proline rich 16 Antibody - Azide and BSA Free

• DSC54
• Mesenchymal stem cell protein DSC54
• MGC104614
• proline rich 16
• proline-rich protein 16

Background

LOC51334( AAH38838, 1 a.a. - 235 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PRR16