Proline rich 16 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Proline rich 16 Antibody [NBP2-13814] - Staining of human cell line BJ shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: Proline rich 16 Antibody [NBP2-13814] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proline rich 16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKA PVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRR16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Proline rich 16 Protein (NBP2-13814PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proline rich 16 Antibody

  • DSC54
  • Mesenchymal stem cell protein DSC54
  • MGC104614
  • proline rich 16
  • proline-rich protein 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P

Publications for Proline rich 16 Antibody (NBP2-13814) (0)

There are no publications for Proline rich 16 Antibody (NBP2-13814).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proline rich 16 Antibody (NBP2-13814) (0)

There are no reviews for Proline rich 16 Antibody (NBP2-13814). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Proline rich 16 Antibody (NBP2-13814) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proline rich 16 Products

Bioinformatics Tool for Proline rich 16 Antibody (NBP2-13814)

Discover related pathways, diseases and genes to Proline rich 16 Antibody (NBP2-13814). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Proline rich 16

There are no specific blogs for Proline rich 16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proline rich 16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRR16