We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

pre-mRNA cleavage factor I (59 kDa subunit) Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: pre-mRNA cleavage factor I (59 kDa subunit) Antibody [NBP1-89868] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Staining of human kidney shows strong nuclear positivity in cells in tubules.
Staining of human rectum shows strong nuclear positivity in glandular cells.
Analysis in human cell line NTERA-2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

pre-mRNA cleavage factor I (59 kDa subunit) Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPSF7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
pre-mRNA cleavage factor I (59 kDa subunit) Protein (NBP1-89868PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for pre-mRNA cleavage factor I (59 kDa subunit) Antibody - BSA Free

  • CFIm59
  • cleavage and polyadenylation specific factor 7, 59kDa
  • CPSF 59 kDa subunit
  • FLJ12529,59 kDa subunit
  • FLJ39024
  • MGC9315
  • pre-mRNA cleavage factor I, 59 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85676
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00008189-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-46276
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868) (0)

There are no publications for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868) (0)

There are no reviews for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional pre-mRNA cleavage factor I (59 kDa subunit) Products

Blogs on pre-mRNA cleavage factor I (59 kDa subunit)

There are no specific blogs for pre-mRNA cleavage factor I (59 kDa subunit), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our pre-mRNA cleavage factor I (59 kDa subunit) Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CPSF7