pre-mRNA cleavage factor I (59 kDa subunit) Antibody


Western Blot: pre-mRNA cleavage factor I (59 kDa subunit) Antibody [NBP1-89868] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: pre-mRNA cleavage factor I (59 kDa subunit) Antibody [NBP1-89868] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: pre-mRNA cleavage factor I (59 kDa subunit) Antibody [NBP1-89868] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
Western Blot: pre-mRNA cleavage factor I (59 kDa subunit) Antibody [NBP1-89868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

pre-mRNA cleavage factor I (59 kDa subunit) Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
Specificity of human, mouse, rat pre-mRNA cleavage factor I (59 kDa subunit) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
pre-mRNA cleavage factor I (59 kDa subunit) Lysate (NBP2-65629)
Control Peptide
pre-mRNA cleavage factor I (59 kDa subunit) Protein (NBP1-89868PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for pre-mRNA cleavage factor I (59 kDa subunit) Antibody

  • CFIm59
  • cleavage and polyadenylation specific factor 7, 59kDa
  • CPSF 59 kDa subunit
  • FLJ12529,59 kDa subunit
  • FLJ39024
  • MGC9315
  • pre-mRNA cleavage factor I, 59 kDa subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IF

Publications for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868) (0)

There are no publications for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868) (0)

There are no reviews for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional pre-mRNA cleavage factor I (59 kDa subunit) Products

Bioinformatics Tool for pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868)

Discover related pathways, diseases and genes to pre-mRNA cleavage factor I (59 kDa subunit) Antibody (NBP1-89868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on pre-mRNA cleavage factor I (59 kDa subunit)

There are no specific blogs for pre-mRNA cleavage factor I (59 kDa subunit), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our pre-mRNA cleavage factor I (59 kDa subunit) Antibody and receive a gift card or discount.


Gene Symbol CPSF7