PPWD1 Antibody


Western Blot: PPWD1 Antibody [NBP1-83050] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPWD1 Antibody [NBP1-83050] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PPWD1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTG
Specificity of human PPWD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPWD1 Protein (NBP1-83050PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPWD1 Antibody

  • EC
  • KIAA0073Spliceosome-associated cyclophilin
  • peptidylprolyl isomerase domain and WD repeat containing 1
  • peptidylprolyl isomerase domain and WD repeat-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for PPWD1 Antibody (NBP1-83050) (0)

There are no publications for PPWD1 Antibody (NBP1-83050).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPWD1 Antibody (NBP1-83050) (0)

There are no reviews for PPWD1 Antibody (NBP1-83050). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPWD1 Antibody (NBP1-83050) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPWD1 Products

Bioinformatics Tool for PPWD1 Antibody (NBP1-83050)

Discover related pathways, diseases and genes to PPWD1 Antibody (NBP1-83050). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPWD1 Antibody (NBP1-83050)

Discover more about diseases related to PPWD1 Antibody (NBP1-83050).

Pathways for PPWD1 Antibody (NBP1-83050)

View related products by pathway.

Blogs on PPWD1

There are no specific blogs for PPWD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPWD1 Antibody and receive a gift card or discount.


Gene Symbol PPWD1